PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_5DS_620A46565.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family FAR1
Protein Properties Length: 773aa    MW: 88994.1 Da    PI: 4.9543
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_5DS_620A46565.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR178.81e-2495182291
                   FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHel 89 
                             Y+eY++++GFsvrk k+++ + ++ i +++++Cskeg +++e+ +  +++ +++etrt+Cka+++ + +++g+w+v+++  eHnHel
  Traes_5DS_620A46565.1  95 LYCEYGHRMGFSVRKGKQYYFTGTKVIRTKDYYCSKEGLKDDEQLT--EANFNKPETRTNCKAMVRFRVDSEGQWRVIQIIPEHNHEL 180
                            7*****************************************9988..9999************************************ PP

                   FAR1  90 ap 91 
                            +p
  Traes_5DS_620A46565.1 181 VP 182
                            86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031011.9E-2295182IPR004330FAR1 DNA binding domain
PfamPF105512.9E-31293387IPR018289MULE transposase domain
PROSITE profilePS509669.619574610IPR007527Zinc finger, SWIM-type
PfamPF044341.5E-5576603IPR007527Zinc finger, SWIM-type
SMARTSM005751.7E-7585612IPR006564Zinc finger, PMZ-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 773 aa     Download sequence    Send to blast
MEGTSVPIEI DGDAICLENV GDDEHEAQES GQVQIIYATE NGAQVAFDSQ EQGTEEHSVR  60
SEEDQENNSV IPSREEFTEE LRTKVAYSEE QAYRLYCEYG HRMGFSVRKG KQYYFTGTKV  120
IRTKDYYCSK EGLKDDEQLT EANFNKPETR TNCKAMVRFR VDSEGQWRVI QIIPEHNHEL  180
VPPEEIHLLR SVRILSIPKP GTLNAMVNAE IQSMHDSLHV HDDGAECHSQ VSIQSYALLE  240
PEDAEALVGY LKRRTIEQGM FYWDVQVDQE GQMTNFFWRD GRSCVDYDCF GDVVVFDTSY  300
RTNKYNMICA PFVGINHHMQ NVMFGCAFML DESVTSYEWL LKSFLESMGG CPPKTIFTDQ  360
NDTISKAIEV ILPETRHCLC QWHIEKNLQA HLDTPNASGT FHSMFMKCMK DCESEAEFEE  420
TWAMMRQEHN LQDDQWLTDL FEQRHKWCTA LHKVAFDCGI RSLDRNFSSH NVLGSIADES  480
TSPTNFALEF DKLVGSWRTN ESVDDIQCKQ ISPECSVKQN SILQHAAEVY THKVYKSLET  540
EFLDGCTGTS YQEMQCSETL YRFEFIMQSS PKVWIVFLDT STMELSCSCK KFEMMGILCS  600
HALNALGLKN LDKIPESYVL KRWTKYVRKG TYVFPSDQSP EQDCTEAVLA YRNRAMWFVY  660
DLLMKSKGHQ DTRKLILDVL ENGEKSLESV CELKRMHIHP SGKDKDASKA EKRKKKLSKQ  720
DKNSRNVKQV VLPPPAESVF VDQPNQNQYF ATEDIATNSS IGISWYWCFS KSD
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3584850.0AK358485.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1077H06.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003578884.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 5-like
TrEMBLW5G2M60.0W5G2M6_WHEAT; Uncharacterized protein
STRINGMLOC_62808.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP1832967
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.17e-82FAR1-related sequence 5
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]